PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK30632.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 375aa    MW: 42793.3 Da    PI: 10.4376
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK30632.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.3e-143989148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT...TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg...kgRtlkqcksrwqkyl 48
                     +g WT+e d+ll +av ++ g++Wk+Ia++++    +R + qc++rwqk+l
       KFK30632.1 39 KGGWTPEADKLLMNAVCRYKGKHWKKIAECVPgrkDKRRDVQCQHRWQKVL 89
                     688********************************89***********986 PP

2Myb_DNA-binding44.82.9e-1495144148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+ll ++vk    +    W+ I++ ++ gR +kqc++rw+++l
       KFK30632.1  95 KGPWSKEEDDLLSELVKANIENdkpKWSNISKQLP-GRIGKQCRERWHNHL 144
                      79***************98887888**********.*************97 PP

3Myb_DNA-binding50.35.5e-16150192145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT eE+ +l++a   +G++ W+ Ia+ ++ gR+++++k++w+
       KFK30632.1 150 KTPWTSEEESILINAQMGHGNK-WAEIAKLLP-GRSENNIKNHWN 192
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.3683489IPR017930Myb domain
SuperFamilySSF466892.24E-1637104IPR009057Homeodomain-like
SMARTSM007173.9E-93891IPR001005SANT/Myb domain
PfamPF002496.9E-123989IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-1941105IPR009057Homeodomain-like
CDDcd001671.12E-74289No hitNo description
PROSITE profilePS5129426.76590148IPR017930Myb domain
SMARTSM007176.0E-1694146IPR001005SANT/Myb domain
CDDcd001672.30E-1097144No hitNo description
PfamPF139211.6E-1698159No hitNo description
Gene3DG3DSA:1.10.10.606.2E-24106151IPR009057Homeodomain-like
SuperFamilySSF466899.58E-28124201IPR009057Homeodomain-like
PROSITE profilePS5129418.251149199IPR017930Myb domain
SMARTSM007172.2E-14149197IPR001005SANT/Myb domain
CDDcd001673.31E-9152192No hitNo description
Gene3DG3DSA:1.10.10.604.3E-21152199IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MTKSNPSNFD IIDEVTPTFV IDSSRGCKRV SGPTRRSTKG GWTPEADKLL MNAVCRYKGK  60
HWKKIAECVP GRKDKRRDVQ CQHRWQKVLN PNLNKGPWSK EEDDLLSELV KANIENDKPK  120
WSNISKQLPG RIGKQCRERW HNHLNPTIKK TPWTSEEESI LINAQMGHGN KWAEIAKLLP  180
GRSENNIKNH WNCSVKKRLA QFPSSPISGS RSSSFESNLD NQGSIWNGML TSTSSHRGEK  240
EKLSSSIEFD WSRHSRKVAL PHWMPSSVLA NVLESPKTPQ SSNESVCIQE VKEIRERLRM  300
AASTFKNTPS IISKSSSPAS CLKRRRQQED TSFQTDCENE KEHSISNSPS SKSRPKHHIS  360
FGSKPLERRL EFDFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-52421999159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-52421999159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_849276.21e-141myb domain protein 3r2
TrEMBLA0A087GL800.0A0A087GL80_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.6__3646__AT4G00540.21e-139(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00540.21e-120myb domain protein 3r2